PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538904.1_FGP007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 302aa    MW: 32823.3 Da    PI: 5.0501
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538904.1_FGP007genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS151.67.3e-4721952187
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalkl..fsev 87 
                        ++lL++cA+a++++d++l+q++L+ l+++a  dgd++qRl+a f+ AL +r +r  ++ +ka+++  ++  +    ++++++a++l  f ++
  KN538904.1_FGP007   2 EQLLVHCANAIEANDATLTQQILWVLNNIAPADGDSNQRLTAAFLCALVSRASR--TGACKAVTAAVADAVEsaalHVHRFTAVELasFIDL 91 
                        79***************************************************9..44454443333322221234666666666689**** PP

               GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvp 175
                        +P+++f++ +aN aI+eaveg   vHi+D++ ++++Q p+L++ La+R+egpp lR+T+ + + s         +ee+g +L +fA++ +++
  KN538904.1_FGP007  92 TPWHRFGYTAANAAIVEAVEGFPVVHIVDLGTTHCMQIPTLIDMLAARAEGPPILRLTVADVAPSApppaLDMPYEELGAKLVNFARSRNMS 183
                        ***********************************************************9886666787777789***************** PP

               GRAS 176 fefnvlvakrle 187
                        ++f+v+ ++  +
  KN538904.1_FGP007 184 MDFRVVPTSPAD 195
                        ****98555444 PP

2GRAS69.66.2e-22205299277373
               GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLv 368
                        r se+r+++E+e +g++++nv+a+eg er+er+e  ++W +r+++aGF++++++e+aa ++k++l+ ++  g+ ++ e++ lvl+Wk++++v
  KN538904.1_FGP007 205 RGSEQRRWYEAE-VGWKVENVLAQEGVERVERQEDRARWGQRMRAAGFRAAAFGEEAAGEVKAMLNDHA-AGWGMKREDDDLVLTWKGHNVV 294
                        788*********.********************************************************.889999**************** PP

               GRAS 369 svSaW 373
                        ++SaW
  KN538904.1_FGP007 295 FASAW 299
                        ***** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.5761302IPR005202Transcription factor GRAS
PfamPF035142.5E-442195IPR005202Transcription factor GRAS
PfamPF035142.2E-19205299IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEQLLVHCAN AIEANDATLT QQILWVLNNI APADGDSNQR LTAAFLCALV SRASRTGACK  60
AVTAAVADAV ESAALHVHRF TAVELASFID LTPWHRFGYT AANAAIVEAV EGFPVVHIVD  120
LGTTHCMQIP TLIDMLAARA EGPPILRLTV ADVAPSAPPP ALDMPYEELG AKLVNFARSR  180
NMSMDFRVVP TSPADALTSL VDQLRGSEQR RWYEAEVGWK VENVLAQEGV ERVERQEDRA  240
RWGQRMRAAG FRAAAFGEEA AGEVKAMLND HAAGWGMKRE DDDLVLTWKG HNVVFASAWA  300
PS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645421.11e-133PREDICTED: scarecrow-like protein 32
SwissprotQ9SN227e-80SCL32_ARATH; Scarecrow-like protein 32
TrEMBLM8AQZ01e-163M8AQZ0_TRIUA; Uncharacterized protein
STRINGBGIOSGA026051-PA1e-133(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.15e-75GRAS family protein